PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG314000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 365aa    MW: 38917.2 Da    PI: 6.706
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG314000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18137189456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++++ eq+++Le+ Fe  +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  Pavir.9NG314000.1.p 137 KRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 189
                          44799***********************************************9 PP

2HD-ZIP_I/II128.42.9e-41135227193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          e+krrls eqv++LE+sFe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L +++++L++e
  Pavir.9NG314000.1.p 135 ERKRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARAENDALLAHNKKLHAE 224
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          +++
  Pavir.9NG314000.1.p 225 IMA 227
                          975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-20110192IPR009057Homeodomain-like
PROSITE profilePS5007116.973131191IPR001356Homeobox domain
SMARTSM003892.5E-18134195IPR001356Homeobox domain
SuperFamilySSF466894.71E-19134193IPR009057Homeodomain-like
CDDcd000864.03E-18136192No hitNo description
PfamPF000468.9E-16137189IPR001356Homeobox domain
PRINTSPR000315.4E-6162171IPR000047Helix-turn-helix motif
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
PRINTSPR000315.4E-6171187IPR000047Helix-turn-helix motif
PfamPF021839.9E-13191230IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MKPMATNGMA PSFFPANFLL QMQQPLPHHP QQQEHHHHHH HHDAGHHEHE APTHHLLAPP  60
PPGLVSPFLH DFGGAMAAPP MLAGGGLGKR MYADGAGDDG NLQHAAADPQ QQDGGAAASD  120
DEEGSAKAGG GCGGERKRRL SVEQVRTLER SFEVANKLEP ERKAQLARAL GLQPRQVAIW  180
FQNRRARWKT KQLEKDYDAL RRQLDAARAE NDALLAHNKK LHAEIMALKG GGGGGGRQEA  240
ASELINLNVK ETEASCSNRS ENSSEINLDI SRAPAPAAAD HESPAAMNGH RGLPFYASAA  300
VDQLLHSGHP SPAAAEPKME LGHGATADTP SATPGGSFGS LLCGAVVDEQ PPFWPWADGH  360
HNFQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134139ERKRRL
2183191RRARWKTKQ
3228236KGGGGGGGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.340860.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983144.11e-176PREDICTED: homeobox-leucine zipper protein HOX23-like
SwissprotQ94GL52e-95HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
SwissprotA2Z7342e-95HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
TrEMBLA0A060D8B11e-153A0A060D8B1_MAIZE; HB transcription factor (Fragment)
STRINGGRMZM5G803812_P011e-153(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-49HD-ZIP family protein